Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0120300_circ_g.1 |
ID in PlantcircBase | osa_circ_017637 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 1120954-1121160 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0120350 |
Parent gene annotation |
Hypothetical protein. (Os03t0120350-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0120300-01:2 Os03t0120300-02:2 Os03t0120300-01:2 Os03t0120350-00:1 Os03t0120300-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.175192271 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1121111-1120956(-) |
Potential amino acid sequence |
MMCLNAFDKEADLDVLNHPILNFFYYLVGYVTTICFSGFLIRCVMMCLNAFDKEADLDVLNHPI LNFFYYLVGYVTTICFSGFLIRCVMMCLNAFDKEADLDVLNHPILNFFYYLVGYVTTICFSGFL IRCVMMCLNAFDKEADLDVLNHPILNFFYYL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |