Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G78920_circ_g.2 |
ID in PlantcircBase | ath_circ_010876 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 29673841-29674283 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G78920 |
Parent gene annotation |
Pyrophosphate-energized membrane proton pump 2 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G78920.1:2 AT1G78920.3:2 AT1G78920.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | gra_circ_001120 |
PMCS | 0.471710437 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29674241-29674280(+) |
Potential amino acid sequence |
MILGGTMAKKCKIEVPLLLVGYGFGASFVALFAQLGGGIYTKGADVGADLVGKVEQGIPEDDPR NPAVIADLVGDNVGDCAARGADLFESIAAEIISAMILGGTMAKKCKIEVPLLLVGYGFGASFVA LFAQLGGGIYTKGADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFESIAAE IISAMILGGTMAKKCKIEVPLLLVGYGFGASFVALFAQLGGGIYTKGADVGADLVGKVEQGIPE DDPRNPAVIADLVGDNVGDCAARGADLFESIAAEIISAMILGGTMAKKCKIE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |