Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_18G224200_circ_g.1 |
| ID in PlantcircBase | gma_circ_009574 |
| Alias | circRNA4886 |
| Organism | Glycine max |
| Position | chr18: 51180069-51180426 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | CIRI, CIRCexplorer |
| Parent gene | GLYMA_18G224200 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | pod |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH00621:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.021293436 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
51180078-51180426(-) |
| Potential amino acid sequence |
MQSDHEKMKTMGQVLSKAKEQLYDCELVTGKLRAMLQTADEQVRGLKKQSTFLSQLAAKTIPDG IHCLSMRLTIDYYLLPLEKRKFPRSENLENPSLYHYALFSDNVLAASVVVNSTIVNAK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021a |