Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G10730_circ_g.2 |
| ID in PlantcircBase | ath_circ_030252 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 6610256-6610650 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI-full |
| Parent gene | AT4G10730 |
| Parent gene annotation |
Protein kinase superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT4G10730_circ_g.1 AT4G10730_circ_g.3 AT4G10730_circ_g.4 AT4G10730_circ_g.5 AT4G10730_circ_g.6 AT4G10730_circ_g.7 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G10730.1:3 AT4G10730.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127865569 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6610567-6610258(-) |
| Potential amino acid sequence |
MQQDLIMNLVNTLQQAAETTDGSQNGKLPPLPRGSDSNGTPTGQAIKESSSHLSFIIPQLQNLF QQNSMQQDLIMNLVNTLQQAAETTDGSQNGKLPPLPRGSDSNGTPTGQAIKESSSHLSFIIPQL QNLFQQNSMQQDLIMNLVNTLQQAAETTDGSQNGKLPPLPRGSDSNGTPTGQAIKESSSHLSFI IPQLQNLFQQNSMQQDLIMNLVNTLQQAAETTDGSQNGKLPPLPRGSDSNGT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |