Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc07g006120.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_002180 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr7: 977078-977512 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc07g006120.2 |
| Parent gene annotation |
Autophagy-related protein 18b |
| Parent gene strand | + |
| Alternative splicing | Solyc07g006120.2_circ_g.1 Solyc07g006120.2_circ_g.2 |
| Support reads | NA |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc07g006120.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.805509686 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
977503-977159(+) 977478-977152(+) 977464-977500(-) |
| Potential amino acid sequence |
MQLRTLCIFTQLGWFISGPSSKYNQRIFASL*(+) MIRIHLVSDATKDFVHFHPAWMVHFWPFQQVQPKDLC*(+) MLLQCEFHLMKDSRLPMVSDERLSHSANGDRKHYRLAKILWLYLLEGPEMNHPSWVKMHKVLSC I*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Tan et al., 2017 |