Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G37130_circ_g.5 |
ID in PlantcircBase | ath_circ_041295 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 14684083-14684377 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G37130 |
Parent gene annotation |
Protein prenylyltransferase superfamily protein |
Parent gene strand | + |
Alternative splicing | AT5G37130_circ_g.1 AT5G37130_circ_g.2 AT5G37130_circ_g.3 AT5G37130_circ_g.4 AT5G37130_circ_g.6 AT5G37130_circ_g.7 AT5G37130_circ_g.8 AT5G37130_circ_g.9 AT5G37130_circ_g.10 AT5G37130_circ_g.11 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G37130.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.182603813 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14684304-14684374(+) |
Potential amino acid sequence |
MGKKSAAVDLINARLLERPNDPRLWEYGELLVSCGYVGEAITIFESLELWDNLIYCYCSMGKKS AAVDLINARLLERPNDPRLWEYGELLVSCGYVGEAITIFESLELWDNLIYCYCSMGKKSAAVDL INARLLERPNDPRLWEYGELLVSCGYVGEAITIFESLELWDNLIYCYCSMGKKSAAVDLINARL LERPNDPRL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |