Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0156700_circ_g.5 |
ID in PlantcircBase | osa_circ_035922 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 3288355-3289532 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0156700 |
Parent gene annotation |
Similar to VAP27. (Os08t0156700-01) |
Parent gene strand | - |
Alternative splicing | Os08g0156700_circ_g.1 Os08g0156700_circ_g.2 Os08g0156700_circ_g.3 Os08g0156700_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0156700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007540* osi_circ_018204 |
PMCS | 0.150417876 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3289505-3289526(-) |
Potential amino acid sequence |
MQLSNLSDDYIAFKVKTTSPKKYSVRPNTGVVLPRSTCDVVVTMQAQREAPPDMQCKDKFLVQS VIAPSGVTVKDITGEMSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |