Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0652100_circ_g.1 |
| ID in PlantcircBase | osa_circ_002938 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 26370209-26370622 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0652100 |
| Parent gene annotation |
Protein of unknown function DUF231, plant domain containing prot ein. (Os01t0652100-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0652100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010456 |
| PMCS | 0.644644976 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26370504-26370546(-) 26370369-26370546(-) |
| Potential amino acid sequence |
MLIFNTWHWWTHTGRDQPWDFVQDGGQVMKDMDRLSAFSKGMSTWARWVDSNVDTSKTRVYFQG ISPTHYKTTGCRWRTTGAPTWWTSSTSPSAAC*(-) MGLCARWRPGDEGHGPALGLLQGDVYMGQMGRFERGHIQDQGLLPGHLSNPLQDYGVSVAYYRS TYLVDIVDESIGRVLKLDSISGDAWLGADMLIFNTWHWWTHTGRDQPWDFVQDGGQVMKDMDRL SAFSKGMSTWARWVDSNVDTSKTRVYFQGISPTHYKTTGCRWRTTGAPTWWTSSTSPSAAC*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |