Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0652100_circ_g.1 |
ID in PlantcircBase | osa_circ_002938 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 26370209-26370622 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0652100 |
Parent gene annotation |
Protein of unknown function DUF231, plant domain containing prot ein. (Os01t0652100-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0652100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010456 |
PMCS | 0.644644976 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26370504-26370546(-) 26370369-26370546(-) |
Potential amino acid sequence |
MLIFNTWHWWTHTGRDQPWDFVQDGGQVMKDMDRLSAFSKGMSTWARWVDSNVDTSKTRVYFQG ISPTHYKTTGCRWRTTGAPTWWTSSTSPSAAC*(-) MGLCARWRPGDEGHGPALGLLQGDVYMGQMGRFERGHIQDQGLLPGHLSNPLQDYGVSVAYYRS TYLVDIVDESIGRVLKLDSISGDAWLGADMLIFNTWHWWTHTGRDQPWDFVQDGGQVMKDMDRL SAFSKGMSTWARWVDSNVDTSKTRVYFQGISPTHYKTTGCRWRTTGAPTWWTSSTSPSAAC*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |