Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0655800_circ_g.8 |
| ID in PlantcircBase | osa_circ_003066 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 26631779-26633805 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0655800 |
| Parent gene annotation |
Similar to ACS-like protein. (Os01t0655800-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0655800_circ_g.2 Os01g0655800_circ_g.3 Os01g0655800_circ_g.4 Os01g0655800_circ_g.5 Os01g0655800_circ_g.6 Os01g0655800_circ_g.7 Os01g0655800_circ_g.9 Os01g0655800_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0655800-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.143049276 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26632322-26631799(+) |
| Potential amino acid sequence |
MYTSGTTGDPKGVLISNASIICLVAGVDRLLNCVNEQLEQTDVYMSYLPLAHIFDRVVEELFMF HGASIGFWRGDVKLLVEDIGTLKPTILCAVPRVLDRIFSGLQAKIASGGFIKSTLFNLAYKFKQ FRMMKGAKHNEAAAICDKVVFSKQSLVLGR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |