Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0783700_circ_g.2 |
| ID in PlantcircBase | osa_circ_022125 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 32514598-32514706 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0783700 |
| Parent gene annotation |
Similar to AP-1 complex subunit sigma-2. (Os03t0783700-00) |
| Parent gene strand | - |
| Alternative splicing | Os03g0783700_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0783700-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.653972477 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32514635-32514638(+) 32514678-32514638(+) 32514686-32514676(-) 32514706-32514676(-) |
| Potential amino acid sequence |
MDNFKDLELIVLSINAHAEIQARIRCQNIGPVLQRSDG*(+) MHMQKYRLAYAAKISVQYFNEVMDNFKDLELIVLSINAHAEIQARIRCQNIGPVLQRSDG*(+) MCIDAEDNELEVLEIIHHFVEVLDRYFGSVCEPVFLHVH*(-) MRACISACALMLRTMSSRSLKLSITSLKYWTDILAAYASLYFCMCIDAEDNELEVLEIIHHFVE VLDRYFGSVCEPVFLHVH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |