Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G38552_circ_g.7 |
| ID in PlantcircBase | ath_circ_035427 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 18027008-18027127 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, circRNA_finder, circseq_cup |
| Parent gene | AT4G38550 |
| Parent gene annotation |
Arabidopsis phospholipase-like protein (PEARLI 4) family |
| Parent gene strand | + |
| Alternative splicing | AT4G38552_circ_g.8 AT4G38552_circ_g.9 AT4G38552_circ_g.10 AT4G38552_circ_g.11 AT4G38552_circ_g.12 |
| Support reads | 11 |
| Tissues | root, leaf, aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G38550.5:1 AT4G38550.3:1 AT4G38550.4:1 AT4G38550.2:1 AT4G38550.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.297876489 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18027027-18027124(+) 18027110-18027010(-) |
| Potential amino acid sequence |
MIKSNLRTCTSKMVMSHRETALHRARFIQQHTKRLIVVVTMIKSNLRTCTSKMVMSHRETALHR ARFIQQHTKRLIVVVTMIKSNLRTCTSKMVMSHRETALHRARFIQQHTKRLIVVVTMIKSNLRT CTSKMVMSHRETALHRARFIQQHTK(+) MKRARWRAVSRCDITILLVQVLKLLFIIVTTTIRRFVCCWMKRARWRAVSRCDITILLVQVLKL LFIIVTTTIRRFVCCWMKRARWRAVSRCDITILLVQVLKLLFIIVTTTIRRFVCCWMKRARWRA VSRCDITILLVQVLKLLFIIVTTTIR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |