Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0520300_circ_g.3 |
ID in PlantcircBase | osa_circ_037725 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 25860707-25861676 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0520300 |
Parent gene annotation |
Similar to Oligouridylate binding protein. (Os08t0520300-01) |
Parent gene strand | - |
Alternative splicing | Os08g0520300_circ_g.2 Os08g0520300_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0520300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.252988935 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25860748-25861604(+) 25861665-25860947(-) |
Potential amino acid sequence |
MVVSFLFLFCIVLCCPITPYLSASKPFPSHFSYSSLSFLLITEGDKTITSGASGFVIPHDSSIT GLLELPFVSTTALWLSVSCFSSALFFVAQLHLICLLPSHFPVISVIAVSASC*(+) MWDNKTGRSRGYGFVSFRNQQEAETAITEMTGKWLGSRQIRCNWATKNNAEEKQETDNHNAVVL TNGSSSNPVMLESCGITKPDAPEVMVLSPSVINRKLRLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |