Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d052660_circ_g.1 |
| ID in PlantcircBase | zma_circ_008199 |
| Alias | zma_circ_0001635 |
| Organism | Zea mays |
| Position | chr4: 196210152-196210892 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d052660 |
| Parent gene annotation |
Outer envelope protein 64 chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d052660_T003:3 Zm00001d052660_T008:2 Zm00001d052660_T001:3 Zm00001d052660_T011:3 Zm00001d052660_T005:3 Zm00001d052660_T014:3 Zm00001d052660_T018:3 Zm00001d052660_T002:3 Zm00001d052660_T006:3 Zm00001d052660_T012:3 Zm00001d052660_T013:3 Zm00001d052660_T016:3 Zm00001d052660_T009:2 Zm00001d052660_T017:3 Zm00001d052660_T007:3 Zm00001d052660_T015:3 Zm00001d052660_T010:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.055343612 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
196210786-196210852(-) |
| Potential amino acid sequence |
MPCKGPRYFPCASKSSASLACLYAKSSVYVITASRTGLYLFNLLRNISVSSRDVICFVLISSPS SITFCTHKLHYQGLGF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |