Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d052660_circ_g.1 |
ID in PlantcircBase | zma_circ_008199 |
Alias | zma_circ_0001635 |
Organism | Zea mays |
Position | chr4: 196210152-196210892 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d052660 |
Parent gene annotation |
Outer envelope protein 64 chloroplastic |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d052660_T003:3 Zm00001d052660_T008:2 Zm00001d052660_T001:3 Zm00001d052660_T011:3 Zm00001d052660_T005:3 Zm00001d052660_T014:3 Zm00001d052660_T018:3 Zm00001d052660_T002:3 Zm00001d052660_T006:3 Zm00001d052660_T012:3 Zm00001d052660_T013:3 Zm00001d052660_T016:3 Zm00001d052660_T009:2 Zm00001d052660_T017:3 Zm00001d052660_T007:3 Zm00001d052660_T015:3 Zm00001d052660_T010:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.055343612 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
196210786-196210852(-) |
Potential amino acid sequence |
MPCKGPRYFPCASKSSASLACLYAKSSVYVITASRTGLYLFNLLRNISVSSRDVICFVLISSPS SITFCTHKLHYQGLGF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |