Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G37850_circ_g.7 |
| ID in PlantcircBase | ath_circ_041414 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 15067581-15067928 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G37850 |
| Parent gene annotation |
pfkB-like carbohydrate kinase family protein |
| Parent gene strand | + |
| Alternative splicing | AT5G37850_circ_g.1 AT5G37850_circ_g.2 AT5G37850_circ_g.3 AT5G37850_circ_g.4 AT5G37850_circ_g.5 AT5G37850_circ_g.6 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G37850.4:2 AT5G37850.1:2 AT5G37850.2:2 AT5G37850.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.146071695 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15067599-15067925(+) |
| Potential amino acid sequence |
MLTPNQFEAEKLTGLRINSEEDGREACAILHAAGPSKVVPLASMLTPNQFEAEKLTGLRINSEE DGREACAILHAAGPSKVVPLASMLTPNQFEAEKLTGLRINSEEDGREACAILHAAGPSKVVPLA SMLTPNQFEAEKLTGLRINSEEDGREACAILHAAGPSK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |