Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0306800_circ_g.1 |
| ID in PlantcircBase | osa_circ_001490 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 11416436-11417846 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0306800 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0306800-01);Hypothetical c onserved gene. (Os01t0306800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 44 |
| Tissues | shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0306800-02:3 Os01t0306800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_001999* |
| PMCS | 0.258484349 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11416508-11416507(+) 11416546-11417835(-) |
| Potential amino acid sequence |
MTQICDKFIEFFMYKKPQTKDWRKVLVFREEWERYRPYFYKHCQARIDMENDSSMKQKLVVLAR KVKKIDNEIEKHMELFTQLRENPTDINAIVARRRKDFTGGFFQHLNFLVNAYNGLDERDAIARL GAKCLSAIHAYDCTLEQLDLDSAQSKFDDILNSSSLDDACDKIKSLAKTKELDSSLILLINRAW AAAKDSTTMKNEGVWLVLLLLMWMTALKVKVHWGTQ*(+) MKNSINLSQIWVIVYPSAPSPSVQSSTLAIVGLATHPHSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |