Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0306800_circ_g.1 |
ID in PlantcircBase | osa_circ_001490 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 11416436-11417846 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os01g0306800 |
Parent gene annotation |
Conserved hypothetical protein. (Os01t0306800-01);Hypothetical c onserved gene. (Os01t0306800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 44 |
Tissues | shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0306800-02:3 Os01t0306800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_001999* |
PMCS | 0.258484349 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11416508-11416507(+) 11416546-11417835(-) |
Potential amino acid sequence |
MTQICDKFIEFFMYKKPQTKDWRKVLVFREEWERYRPYFYKHCQARIDMENDSSMKQKLVVLAR KVKKIDNEIEKHMELFTQLRENPTDINAIVARRRKDFTGGFFQHLNFLVNAYNGLDERDAIARL GAKCLSAIHAYDCTLEQLDLDSAQSKFDDILNSSSLDDACDKIKSLAKTKELDSSLILLINRAW AAAKDSTTMKNEGVWLVLLLLMWMTALKVKVHWGTQ*(+) MKNSINLSQIWVIVYPSAPSPSVQSSTLAIVGLATHPHSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |