Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc11g010270.1_circ_g.1 |
| ID in PlantcircBase | sly_circ_003264 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr11: 3356043-3356413 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc11g010270.1 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc11g010270.1.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.758148162 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3356389-3356082(+) 3356124-3356412(-) 3356362-3356356(-) |
| Potential amino acid sequence |
MAVPMVLVISLARASLSCLRDS*(+) MFLKPILIHSNTTMNLSNMTMKLLPKR*(-) MLELGLDEEGCVEESGQKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQ NRRARWKTKQLERDYNVLKANFDSLKHNYESLKHDNEALAKEMTRTMGTAMCIQQETFSLC*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Tan et al., 2017 |