Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g010270.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003264 |
Alias | NA |
Organism | Solanum lycopersicum |
Position | chr11: 3356043-3356413 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | Segemehl, CIRI |
Parent gene | Solyc11g010270.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc11g010270.1.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.758148162 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3356389-3356082(+) 3356124-3356412(-) 3356362-3356356(-) |
Potential amino acid sequence |
MAVPMVLVISLARASLSCLRDS*(+) MFLKPILIHSNTTMNLSNMTMKLLPKR*(-) MLELGLDEEGCVEESGQKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQ NRRARWKTKQLERDYNVLKANFDSLKHNYESLKHDNEALAKEMTRTMGTAMCIQQETFSLC*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Tan et al., 2017 |