Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G264700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000981 |
| Alias | Chr09:21905591|21906401 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 21905591-21906401 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G264700 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.009G264700.3:2 Gorai.009G264700.1:2 Gorai.009G264700.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.795849157 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21906369-21905593(-) |
| Potential amino acid sequence |
MTIEKISLPPNISYGLVRSYLLHYGYEDTLNSFDLASKSTIPPICIAQENGFDEQDVVYALNQR KTIRQEYEAQERLKQQMTIEKISLPPNISYGLVRSYLLHYGYEDTLNSFDLASKSTIPPICIAQ ENGFDEQDVVYALNQRKTIRQEYEAQERLKQQMTIEKISLPPNISYGLVRSYLLHYGYEDTLNS FDLASKSTIPPICIAQENGFDEQDVVYALNQRKTIRQEYEAQERLKQQMTIEKISLPPNISYGL VRSYLLHYGYEDTLNSFDLASKSTIPPICIAQENGFDEQDVVYALNQRKTIRQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |