Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G205900_circ_g.1 |
| ID in PlantcircBase | gra_circ_001241 |
| Alias | Chr11:49743126|49743852 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 49743126-49743852 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G205900 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G205900.5:3 Gorai.011G205900.4:3 Gorai.011G205900.1:3 Gorai.011G205900.2:3 Gorai.011G205900.3:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.494521515 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
49743486-49743166(+) |
| Potential amino acid sequence |
MKLLQSSLCTKDMCLISLLVPLTKLVLLNLKLLLRKPGDSLCLQKVLVTQYLRTLLGVFSVQRT RILDYLQNLGGAPERSLAHSC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |