Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G14310_circ_g.1 |
| ID in PlantcircBase | ath_circ_002488 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 4885523-4885954 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI |
| Parent gene | AT1G14310 |
| Parent gene annotation |
F14L17.7 protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G14310.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.14643779 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4885930-4885951(+) |
| Potential amino acid sequence |
MSLLKDAGGLKTTPAEIKEGFKRVFSAPWPEKLRYQGDGRPFWKLVVSEATGCSDNDYFEDVYQ YYANGEAWHLPEGAYETMSLLKDAGGLKTTPAEIKEGFKRVFSAPWPEKLRYQGDGRPFWKLVV SEATGCSDNDYFEDVYQYYANGEAWHLPEGAYETMSLLKDAGGLKTTPAEIKEGFKRVFSAPWP EKLRYQGDGRPFWKLVVSEATGCSDNDYFEDVYQYYANGEAWHLPEGAYETMSLLKDAG(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |