Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0191700_circ_g.12 |
| ID in PlantcircBase | osa_circ_000677 |
| Alias | Os_ciR6534 |
| Organism | Oryza sativa |
| Position | chr1: 4907711-4907840 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0191700 |
| Parent gene annotation |
Similar to Pyrophosphate-fructose-6-phosphate 1-phosphotransfera se-like protein (Pyrophosphate-dependent phosphofructo-1-kinase- like protein). (Os01t0191700-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0191700_circ_g.11 Os01g0191700_circ_g.13 Os01g0191700_circ_g.14 Os01g0191700_circ_g.15 Os01g0191700_circ_g.16 Os01g0191700_circ_g.17 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0191700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.558012949 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4907781-4907768(-) |
| Potential amino acid sequence |
MSSIDGPLSLLHRSVKTKGLVDHHCCAPLVSQHQCHSLHSQPQHEQH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |