Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0292900_circ_g.1 |
| ID in PlantcircBase | osa_circ_001425 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 10653242-10654717 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0292900 |
| Parent gene annotation |
Similar to Squamosa-promoter binding-like protein 2. (Os01t02929 00-01);Similar to Squamosa-promoter binding-like protein 2. (Os0 1t0292900-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0292900_circ_g.2 Os01g0292900_circ_g.3 |
| Support reads | 41 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0292900-01:6 Os01t0292900-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119799198 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10653338-10653242(+) |
| Potential amino acid sequence |
MLKNANSAAIASHTGNYVAKGNSLHDSRPHIPVGTESTAEEPTVERRVQNFDLNDAYVEGDENR TDKIVFKLFGKEPNDFPSDLRAQILSWLSNCPSDIESYIRPGCIILTIYMRLPNWMWDKLAADP AHWIQKLISLSTDTLWRTGWMYARVQDYLTLSCNGNLMLASPWQPAIGNKHQILFITPIAVACS STANFSVKGLNIAQPTTN*(+) |
| Sponge-miRNAs | osa-miR2864.1 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |