Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0292900_circ_g.1 |
ID in PlantcircBase | osa_circ_001425 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 10653242-10654717 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os01g0292900 |
Parent gene annotation |
Similar to Squamosa-promoter binding-like protein 2. (Os01t02929 00-01);Similar to Squamosa-promoter binding-like protein 2. (Os0 1t0292900-02) |
Parent gene strand | + |
Alternative splicing | Os01g0292900_circ_g.2 Os01g0292900_circ_g.3 |
Support reads | 41 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0292900-01:6 Os01t0292900-02:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.119799198 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10653338-10653242(+) |
Potential amino acid sequence |
MLKNANSAAIASHTGNYVAKGNSLHDSRPHIPVGTESTAEEPTVERRVQNFDLNDAYVEGDENR TDKIVFKLFGKEPNDFPSDLRAQILSWLSNCPSDIESYIRPGCIILTIYMRLPNWMWDKLAADP AHWIQKLISLSTDTLWRTGWMYARVQDYLTLSCNGNLMLASPWQPAIGNKHQILFITPIAVACS STANFSVKGLNIAQPTTN*(+) |
Sponge-miRNAs | osa-miR2864.1 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |