Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0654300_circ_g.2 |
| ID in PlantcircBase | osa_circ_031817 |
| Alias | Os_ciR10536 |
| Organism | Oryza sativa |
| Position | chr6: 26810595-26811303 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0654300 |
| Parent gene annotation |
Similar to Histidine kinase (Fragment). (Os06t0654300-00) |
| Parent gene strand | + |
| Alternative splicing | Os06g0654300_circ_igg.1 Os06g0654300_circ_igg.2 Os06g0654300_circ_g.1 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0654300-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.228663987 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26811233-26810645(+) 26811246-26810610(+) |
| Potential amino acid sequence |
MQASDDHARKYGGTGLGLAICKQLVTGDVLRIRQILTNLIR*(+) MIMQENMAEQGLALRYASSWSLVMC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |