Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0509300_circ_g.3 |
| ID in PlantcircBase | osa_circ_039763 |
| Alias | Os_ciR11878 |
| Organism | Oryza sativa |
| Position | chr9: 19761797-19765665 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0509350 |
| Parent gene annotation |
Hypothetical protein. (Os09t0509350-00) |
| Parent gene strand | - |
| Alternative splicing | Os09g0509300_circ_g.1 Os09g0509300_circ_g.2 Os09g0509300_circ_g.4 Os09g0509300_circ_g.5 Os09g0509300_circ_g.6 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0509300-01:8 Os09t0509350-00:6 Os09t0509300-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.244584499 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19761868-19765621(-) |
| Potential amino acid sequence |
MHYLQSLLQQKADCHNSSSYLPYPYVLLTDSVAPDNGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |