Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G16170_circ_g.1 |
ID in PlantcircBase | ath_circ_022111 |
Alias | Ath_circ_FC4987 |
Organism | Arabidpsis thaliana |
Position | chr3: 5476753-5476938 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | AT3G16170 |
Parent gene annotation |
AMP-dependent synthetase and ligase family protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 6 |
Tissues | inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G16170.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.408456436 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5476927-5476935(+) |
Potential amino acid sequence |
MNDSGGQETKKYEGFGSLKGARIGIVAKPSAEFVAGVLGTWFSGGVAVPLALSYPEAELLHVMN DSGGQETKKYEGFGSLKGARIGIVAKPSAEFVAGVLGTWFSGGVAVPLALSYPEAELLHVMNDS GGQETKKYEGFGSLKGARIGIVAKPSAEFVAGVLGTWFSGGVAVPLALSYPEAELLHVMNDS(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |