Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G16170_circ_g.1 |
| ID in PlantcircBase | ath_circ_022111 |
| Alias | Ath_circ_FC4987 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 5476753-5476938 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | AT3G16170 |
| Parent gene annotation |
AMP-dependent synthetase and ligase family protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G16170.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.408456436 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5476927-5476935(+) |
| Potential amino acid sequence |
MNDSGGQETKKYEGFGSLKGARIGIVAKPSAEFVAGVLGTWFSGGVAVPLALSYPEAELLHVMN DSGGQETKKYEGFGSLKGARIGIVAKPSAEFVAGVLGTWFSGGVAVPLALSYPEAELLHVMNDS GGQETKKYEGFGSLKGARIGIVAKPSAEFVAGVLGTWFSGGVAVPLALSYPEAELLHVMNDS(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |