Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0737800_circ_g.3 |
| ID in PlantcircBase | osa_circ_003797 |
| Alias | Os_ciR2498 |
| Organism | Oryza sativa |
| Position | chr1: 30778353-30778641 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0737800 |
| Parent gene annotation |
Similar to Farnesyltransferase beta subunit. (Os01t0737800-01);S imilar to Protein farnesyltransferase beta subunit (EC 2.5.1.58) (CAAX farnesyltransferase beta subunit) (RAS proteins prenyltra nsferase beta) (FTase-beta). (Os01t0737800-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0737800_circ_g.2 |
| Support reads | 10/9 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0737800-02:2 Os01t0737800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.286019839 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30778572-30778626(-) |
| Potential amino acid sequence |
MCSMPIDLGCATGLFMHLLCWMKYLTMLRMILWTSYLDVRLELWREQHVEYLTRGLKHLGPSFH VLDANRPWLCYWIIHALALLDEIPDDVEDDIVDFLSRCQVRAVA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |