Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0148700_circ_g.5 |
| ID in PlantcircBase | osa_circ_041998 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 2789170-2789797 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os05g0148700 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os05t0148700-01) ;Similar to OSA15 protein. (Os05t0148700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0148700-02:4 Os05t0148700-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.198506781 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2789192-2789191(+) 2789738-2789186(+) 2789395-2789790(-) 2789189-2789597(-) |
| Potential amino acid sequence |
MMANRLQEQFAKDGSSSPANSRSFITLEKNGNTFELFPHEVSTDQITAIEQAYWSMASALSEAD GIDYTDPEELELLVATLIDLDAMDGKKSVSLLAECSSSPDVNTSLFGISMT*(+) MGKRVFPYLLNVQALQMLIPVCSGYP*(+) MKLLELAGEEEPSFANCSCNLFAIMSWISRTNWY*(-) MDIPNKLVLTSGELEHSASKETLFFPSMASRSMRVATNNSSSSGSV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |