Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0177900_circ_g.3 |
| ID in PlantcircBase | osa_circ_013463 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 4308360-4308661 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0177900 |
| Parent gene annotation |
Carbohydrate kinase, FGGY domain containing protein. (Os02t01779 00-01);Carbohydrate kinase, FGGY family protein. (Os02t0177900-0 2) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0178000-01:2 Os02t0177900-02:1 Os02t0178000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.171080464 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4308572-4308364(+) 4308422-4308641(-) |
| Potential amino acid sequence |
MVDNQQEVQTGSHHKTRRLQLPHHNSCAESLL*(+) MAQCPSEEDYNQDTGSISYNSDSAQEL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |