Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G26190_circ_g.2 |
| ID in PlantcircBase | ath_circ_014900 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 11148896-11149304 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G26190 |
| Parent gene annotation |
IQ domain-containing protein IQM4 |
| Parent gene strand | - |
| Alternative splicing | AT2G26190_circ_g.1 AT2G26190_circ_g.3 |
| Support reads | 3 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G26190.1:3 AT2G26190.3:3 AT2G26190.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.262199183 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11149090-11148898(-) |
| Potential amino acid sequence |
MSAQPFFYWLDIGDGKDVNLEHHPRSVLQKQCIKYLGPVGKGLSKDEKAQKLALQHWLEAIDPR HRYGHNLHFYYDVWSASMSAQPFFYWLDIGDGKDVNLEHHPRSVLQKQCIKYLGPVGKGLSKDE KAQKLALQHWLEAIDPRHRYGHNLHFYYDVWSASMSAQPFFYWLDIGDGKDVNLEHHPRSVLQK QCIKYLGPVGKGLSKDEKAQKLALQHWLEAIDPRHRYGHNLHFYYDVWSASMSAQPFFYWLDIG DGKDVNLEHHPRSVLQKQCIKYLGP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |