Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0494000_circ_g.4 |
| ID in PlantcircBase | osa_circ_007280 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 18756460-18757141 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os10g0494000 |
| Parent gene annotation |
Protein of unknown function DUF789 family protein. (Os10t0494000 -01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 13 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0494000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.28615358 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18757101-18756993(-) |
| Potential amino acid sequence |
MDSVEYFNLADLWEQYYEWSAYGAGTTVQLYGGERVVQYYVPYLSGIQLYTNKAQTASRSFGED NGMDYWSDDEDNEKMSRSWSSTSEDSLFNCDAISGNRKRHGHMYFEFFEVCSPYGRIPLIDKVY ELSQSYPGLTSLRSVDLSPASWMSVAWRMAGFRAILGTTPRWTASSTSTSRTYGSSTMSGARTG LELRCSCMEGKE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |