Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0690400_circ_g.1 |
| ID in PlantcircBase | osa_circ_035429 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 29364253-29364424 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | Os07g0690400 |
| Parent gene annotation |
Similar to Calmodulin-binding protein phosphatase. (Os07t0690400 -01);Similar to Calmodulin-binding protein phosphatase. (Os07t06 90400-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | anther |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0690400-01:1 Os07t0690400-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.420682897 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29364320-29364319(+) 29364305-29364397(-) |
| Potential amino acid sequence |
MSALPPDIGRDDWLQALPRALVAGFVKADIDFQRKGVRRPQRGLGGGLQQGAFARARHERAAAG HRPRRLATGAAAGARRRLRQGRHRLPAQGCSTATTGSRRRSTARSICSSTS*(+) MLLAVDRRRDPVVAVEHPCAGSRCRP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |