Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G26720_circ_g.8 |
ID in PlantcircBase | ath_circ_023971 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 9821869-9822728 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G26720 |
Parent gene annotation |
Alpha-mannosidase At3g26720 |
Parent gene strand | + |
Alternative splicing | AT3G26720_circ_g.7 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G26720.2:3 AT3G26720.5:3 AT3G26720.1:3 AT3G26720.4:3 AT3G26720.3:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.121832771 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9822687-9822725(+) |
Potential amino acid sequence |
MAKVELKKLFHNKKEGDSWINSHKTTFSAFEPSYSLPKNVALLTLQELENGEVLLRLAHLFEVG EDSEYSVMAKVELKKLFHNKKEGDSWINSHKTTFSAFEPSYSLPKNVALLTLQELENGEVLLRL AHLFEVGEDSEYSVMAKVELKKLFHNKKEGDSWINSHKTTFSAFEPSYSLPKNVALLTLQELEN GEVLLRLAHLFEVGEDSEYSVMAKVELKKLFHNKK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |