Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d013276_circ_g.1 |
ID in PlantcircBase | zma_circ_008377 |
Alias | zma_circ_0002176 |
Organism | Zea mays |
Position | chr5: 7623637-7624024 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d013276 |
Parent gene annotation |
Myosin-12 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d013276_T001:2 Zm00001d013276_T009:2 Zm00001d013276_T013:2 Zm00001d013276_T006:2 Zm00001d013276_T016:2 Zm00001d013276_T004:2 Zm00001d013276_T005:2 Zm00001d013276_T008:2 Zm00001d013276_T007:2 Zm00001d013276_T003:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.28792326 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7623958-7623673(+) 7623960-7623957(-) |
Potential amino acid sequence |
MSSTPAGGASVSLGYTLPRLATTCSRRPRWRRDEG*(+) MTKLAYLHEPGVLHNLSCRYGLNEIYTYTGNILIAVNPFQRLPHLYDVHMMEQYKGASFGELSP HLFAIADACYRSWRALAAYTPRTRRRRRQEWTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |