Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0440800_circ_g.1 |
ID in PlantcircBase | osa_circ_037207 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 21448793-21449365 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0440800 |
Parent gene annotation |
Glyceraldehyde-3-phosphate dehydrogenase. (Os08t0440800-01) |
Parent gene strand | + |
Alternative splicing | Os08g0440800_circ_g.2 Os08g0440800_circ_g.3 Os08g0440800_circ_g.4 Os08g0440800_circ_g.5 Os08g0440800_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0440800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.290875596 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21449014-21448805(+) 21448828-21449327(-) |
Potential amino acid sequence |
MVHCFHLAGFPKGLINCVTGKGSEIGDFLTMHPGVNCISFTGGDTGIAISKKAGMVPLQMELGG KDACVVLEDADLDLVAANIVKGGFSYRYLLE*(+) MVGLPKLLQEVPVREASFYYICCH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |