Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0440800_circ_g.1 |
| ID in PlantcircBase | osa_circ_037207 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 21448793-21449365 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0440800 |
| Parent gene annotation |
Glyceraldehyde-3-phosphate dehydrogenase. (Os08t0440800-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0440800_circ_g.2 Os08g0440800_circ_g.3 Os08g0440800_circ_g.4 Os08g0440800_circ_g.5 Os08g0440800_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0440800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.290875596 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21449014-21448805(+) 21448828-21449327(-) |
| Potential amino acid sequence |
MVHCFHLAGFPKGLINCVTGKGSEIGDFLTMHPGVNCISFTGGDTGIAISKKAGMVPLQMELGG KDACVVLEDADLDLVAANIVKGGFSYRYLLE*(+) MVGLPKLLQEVPVREASFYYICCH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |