Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0659100_circ_g.5 |
| ID in PlantcircBase | osa_circ_025777 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 33629272-33630187 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0659100 |
| Parent gene annotation |
Glutamine synthetase shoot isozyme, chloroplast precursor (EC 6. 3.1.2) (Glutamate--ammonia ligase) (Clone lambda-GS31). (Os04t06 59100-01);Similar to Isoform 2 of Glutamine synthetase, chloropl astic. (Os04t0659100-02);Glutamine synthetase shoot isozyme, chl oroplast precursor (EC 6.3.1.2) (Glutamate--ammonia ligase) (Clo ne lambda-GS31). (Os04t0659100-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0659100_circ_g.2 Os04g0659100_circ_igg.1 Os04g0659100_circ_g.2 Os04g0659100_circ_g.3 Os04g0659100_circ_g.4 Os04g0659100_circ_g.6 Os04g0659100_circ_g.7 Os04g0659100_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0659100-01:5 Os04t0659100-03:5 Os04t0659100-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.189194878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33629477-33629351(-) 33629578-33630169(-) |
| Potential amino acid sequence |
MVWNRTGVHFAPERRKLASWLARWRLPWAPGLEELELTSEANQGQYQNQWRTPRSYQNGTTMDQ AQGKLQEKIVKSSYTHRLYSRTHFEVATTYWLCVIPTHQLGNPSLLTNVTGLHKYSVIQRLSAK CHGLE*(-) MCDTYTPAGEPIPTNKRNRAAQVFSDPKVVSQVPWFGIEQEYTLLQRDVNWPLGWPVGGYPGPQ GWRNWN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |