Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G20280_circ_g.1 |
| ID in PlantcircBase | ath_circ_013972 |
| Alias | At_ciR5258 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 8740368-8740697 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT2G20280 |
| Parent gene annotation |
Zinc finger CCCH domain-containing protein 21 |
| Parent gene strand | - |
| Alternative splicing | AT2G20280_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G20280.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.220561919 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8740671-8740370(-) |
| Potential amino acid sequence |
MTPALFMEWKRKKIAERDAGLAASQAERAKNDRMSGRELFLSNASLFVDDAEACEEYEREREQE ETEQKRAKLQTATQMTPALFMEWKRKKIAERDAGLAASQAERAKNDRMSGRELFLSNASLFVDD AEACEEYEREREQEETEQKRAKLQTATQMTPALFMEWKRKKIAERDAGLAASQAERAKNDRMSG RELFLSNASLFVDDAEACEEYEREREQEETEQKRAKLQTATQMTPALFMEWKRKKIAERDAGLA ASQAERAKNDRMSGRELFLSNASLFVDDAEACEEYEREREQEETEQK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |