Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G20280_circ_g.1 |
ID in PlantcircBase | ath_circ_013972 |
Alias | At_ciR5258 |
Organism | Arabidpsis thaliana |
Position | chr2: 8740368-8740697 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT2G20280 |
Parent gene annotation |
Zinc finger CCCH domain-containing protein 21 |
Parent gene strand | - |
Alternative splicing | AT2G20280_circ_g.2 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G20280.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.220561919 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8740671-8740370(-) |
Potential amino acid sequence |
MTPALFMEWKRKKIAERDAGLAASQAERAKNDRMSGRELFLSNASLFVDDAEACEEYEREREQE ETEQKRAKLQTATQMTPALFMEWKRKKIAERDAGLAASQAERAKNDRMSGRELFLSNASLFVDD AEACEEYEREREQEETEQKRAKLQTATQMTPALFMEWKRKKIAERDAGLAASQAERAKNDRMSG RELFLSNASLFVDDAEACEEYEREREQEETEQKRAKLQTATQMTPALFMEWKRKKIAERDAGLA ASQAERAKNDRMSGRELFLSNASLFVDDAEACEEYEREREQEETEQK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |