Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G10700_circ_g.2 |
ID in PlantcircBase | ath_circ_020925 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 3348369-3348911 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE |
Parent gene | AT3G10700 |
Parent gene annotation |
GalAK |
Parent gene strand | - |
Alternative splicing | AT3G10700_circ_g.3 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G10700.1:3 AT3G10700.2:3 AT3G10700.3:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187911095 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3348381-3348371(-) |
Potential amino acid sequence |
MDCKGIIGYLSGSNGLDSSGLSSSAAVGVAYLLALENANELTVSPTENIEYDRLIENGYLGLRN GILDQSAILLSNYGCLTYMDCKGIIGYLSGSNGLDSSGLSSSAAVGVAYLLALENANELTVSPT ENIEYDRLIENGYLGLRNGILDQSAILLSNYGCLTYMDCKGIIGYLSGSNGLDSSGLSSSAAVG VAYLLALENANELTVSPTENIEYDRLIENGYLGLRNGILDQSAILLSNYGCLTYMDCK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |