Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0527600_circ_g.5 |
ID in PlantcircBase | osa_circ_014885 |
Alias | Os_ciR7781 |
Organism | Oryza sativa |
Position | chr2: 19327059-19327392 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0527600 |
Parent gene annotation |
Similar to CTR1-like protein kinase. (Os02t0527600-01) |
Parent gene strand | - |
Alternative splicing | Os02g0527600_circ_g.2 Os02g0527600_circ_g.3 Os02g0527600_circ_g.4 Os02g0527600_circ_g.6 Os02g0527600_circ_g.7 Os02g0527600_circ_g.8 |
Support reads | 2/4 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0527600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.140718214 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19327324-19327389(-) |
Potential amino acid sequence |
MAFDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |