Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0802400_circ_g.6 |
| ID in PlantcircBase | osa_circ_017000 |
| Alias | Os02circ29232 |
| Organism | Oryza sativa |
| Position | chr2: 34208296-34208405 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0802400 |
| Parent gene annotation |
Similar to calcineurin subunit B. (Os02t0802400-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0802400_circ_g.2 Os02g0802400_circ_g.3 Os02g0802400_circ_g.4 Os02g0802400_circ_g.5 Os02g0802400_circ_g.7 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0802400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.233333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34208316-34208315(+) |
| Potential amino acid sequence |
MNDPVWSRKTSTRSLKVTFPLPSMSYTLNITLFVPLS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |