Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G56140_circ_g.4 |
| ID in PlantcircBase | ath_circ_007700 |
| Alias | At_ciR4304 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 21005807-21006502 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT1G56140 |
| Parent gene annotation |
Probable LRR receptor-like serine/threonine-protein kinase At1g5 6140 |
| Parent gene strand | - |
| Alternative splicing | 1_circ_ag.9 1_circ_ag.10 AT1G56120_circ_g.1 1_circ_ag.2 AT1G56120_circ_g.3 1_circ_ag.4 AT1G56120_circ_g.5 1_circ_ag.6 1_circ_ag.7 1_circ_ag.8 1_circ_ag.9 1_circ_ag.10 1_circ_ag.11 AT1G56140_circ_g.1 AT1G56140_circ_g.2 AT1G56140_circ_g.3 AT1G56140_circ_g.5 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G56140.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152953879 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21006056-21005809(-) |
| Potential amino acid sequence |
MELTGQIPDFIGDWTKLTTLRILGTGLSGPIPASFSNLTSLTELSISSNNFSGSIPDEIGRCTK LQQIYIDSSGLSGGLPVSFANLVELEQAWIADMELTGQIPDFIGDWTKLTTLRILGTGLSGPIP ASFSNLTSLTELSISSNNFSGSIPDEIGRCTKLQQIYIDSSGLSGGLPVSFANLVELEQAWIAD MELTGQIPDFIGDWTKLTTLRILGTGLSGPIPASFSNLTSLTELSISSNNFSGSIPDEIGRCTK LQQIYIDSSGLSGGLPVSFANLVELEQAWIADMELTGQIPDFIGDWTKLTTLRILGTGLSGPIP ASFSNLTSLTE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |