Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0228900_circ_g.1 |
| ID in PlantcircBase | osa_circ_010875 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 7018886-7020244 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0228900 |
| Parent gene annotation |
Similar to Leucine Rich Repeat family protein, expressed. (Os12t 0228900-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0228900_circ_g.2 Os12g0228900_circ_g.3 Os12g0228900_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0228900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.231140701 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7019392-7018886(+) 7019363-7020213(-) |
| Potential amino acid sequence |
MTSRSDIILTNINFSSLLPCNKS*(+) MQPLFAKIIVHTLLGSSSGIRTLEISENNIAGWLKTMDKRFACFSSALESNISLNSLTLLNLRG NNLNKGDIEDLCKILVKMPNLRDLDISDNPIMDEGIRICCKVASWKS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |