Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0228900_circ_g.1 |
ID in PlantcircBase | osa_circ_010875 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 7018886-7020244 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0228900 |
Parent gene annotation |
Similar to Leucine Rich Repeat family protein, expressed. (Os12t 0228900-01) |
Parent gene strand | - |
Alternative splicing | Os12g0228900_circ_g.2 Os12g0228900_circ_g.3 Os12g0228900_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0228900-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.231140701 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7019392-7018886(+) 7019363-7020213(-) |
Potential amino acid sequence |
MTSRSDIILTNINFSSLLPCNKS*(+) MQPLFAKIIVHTLLGSSSGIRTLEISENNIAGWLKTMDKRFACFSSALESNISLNSLTLLNLRG NNLNKGDIEDLCKILVKMPNLRDLDISDNPIMDEGIRICCKVASWKS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |