Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0472500_circ_g.1 |
| ID in PlantcircBase | osa_circ_033736 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 16975189-16976181 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0472500 |
| Parent gene annotation |
Similar to Myosin heavy chain-like protein (Fragment). (Os07t047 2500-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0472500_circ_g.2 Os07g0472500_circ_g.3 Os07g0472500_circ_g.4 Os07g0472500_circ_g.5 Os07g0472500_circ_g.6 Os07g0472500_circ_g.7 Os07g0472500_circ_g.8 Os07g0472500_circ_g.9 Os07g0472500_circ_g.10 Os07g0472500_circ_g.11 Os07g0472500_circ_g.12 Os07g0472500_circ_g.13 Os07g0472500_circ_g.14 Os07g0472500_circ_g.15 Os07g0472500_circ_g.16 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0472500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017047 |
| PMCS | 0.24436879 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16976106-16975204(+) 16975201-16975212(+) |
| Potential amino acid sequence |
MRHVLPWRPGIMSLRSCDNRCLKKNSSAENG*(+) MDKELKERDEKYVELDTKFQRLHKRAKQRIQDIQKEKDDMEARFNEINQKAEQASSLQSAAQQE LERARQQASEALRSMDAERQQLRTVNSKLRTNLDEARVALEARNNVLEKLRQSMFEKEQLSRKW IKN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |