Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0132100_circ_g.1 |
| ID in PlantcircBase | osa_circ_026436 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 1867341-1867460 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0132100 |
| Parent gene annotation |
AMP-dependent synthetase and ligase domain containing protein. ( Os05t0132100-02);Similar to cDNA clone:001-200-C01, full insert sequence. (Os05t0132100-03);Similar to cDNA clone:001-200-C01, f ull insert sequence. (Os05t0132100-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0132100-04:1 Os05t0132100-03:1 Os05t0132100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.403462778 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1867358-1867344(+) 1867381-1867343(-) |
| Potential amino acid sequence |
MLFLFFFIVAVTKSLSRSKGIGSNITPLTYSNPRSL*(+) MKKKRNNMLKYYKLRGFEYVKGVILDPIPFDLERDLVTATMKKKRNNMLKYYKLRGFEYVKGVI LDPIPFDLERDLVTATMKKKRNNMLKYYKLRGFEYVKGVILDPIPFDLERDLVTATMKKKRNNM LKYYK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |