Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0497500_circ_g.1 |
| ID in PlantcircBase | osa_circ_014709 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 17497269-17497707 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0497500 |
| Parent gene annotation |
Similar to DNA repair protein Rad50. (Os02t0497500-01);Similar t o DNA repair protein Rad50. (Os02t0497500-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0497500_circ_g.2 Os02g0497500_circ_igg.1 Os02g0497600_circ_g.1 Os02g0497500_circ_igg.2 |
| Support reads | 1 |
| Tissues | anther |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0497500-02:2 Os02t0497500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011760 |
| PMCS | 0.247336295 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17497687-17497671(-) 17497302-17497671(-) |
| Potential amino acid sequence |
MRQMYEPFENLARELHMCPCCQRAFTPDEEDEFVKKQRTTCESTADRMNKISLECSNAEDFFQQ LNKLNATYEEFVKLGKEAIPLAEKNLKQLLADESEKAQTFDDQFKLREGNAANV*(-) MKVRRHKHLMINLSYAKGMRQMYEPFENLARELHMCPCCQRAFTPDEEDEFVKKQRTTCESTAD RMNKISLECSNAEDFFQQLNKLNATYEEFVKLGKEAIPLAEKNLKQLLADESEKAQTFDDQFKL REGNAANV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |