Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0573200_circ_g.2 |
| ID in PlantcircBase | osa_circ_040292 |
| Alias | Os_ciR11964 |
| Organism | Oryza sativa |
| Position | chr9: 22937206-22938263 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0573200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os09t0573200-01);Protein of unknow n function DUF3550/UPF0682 domain containing protein. (Os09t0573 200-02);Similar to predicted protein. (Os09t0573200-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0573200-03:2 Os09t0573200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.280090714 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22937889-22937227(+) 22937243-22938209(-) |
| Potential amino acid sequence |
MLLSPSCRSSSAGFSGDSVRQIGSQFTMFLTAPLQAFCHLIGNNGVDIDRDTYNKAEELLSLSL NEWATTLVASSSLHPVWVEVLGDPLLRRLLLRFKLYIPL*(+) MESDHKGIYSLNLRRSRLKSGSPKTSTQTG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |