Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0309300_circ_g.1 |
| ID in PlantcircBase | osa_circ_036661 |
| Alias | Os_ciR11362 |
| Organism | Oryza sativa |
| Position | chr8: 13028720-13028900 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0309300 |
| Parent gene annotation |
RER1A protein (AtRER1A). (Os08t0309300-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0309300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.374049033 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13028893-13028812(+) 13028784-13028888(-) 13028747-13028888(-) |
| Potential amino acid sequence |
MEYLLPEGEWNISVFYHMKNLSLHCDCKQNHPIE*(+) MKRQILHMIKYRYVPFSFGKQVFHC*(-) MFHSPSGSRYSIVKAFCIAFVLTFFSVFDVPVFWPILLFYWVVLFTVTMKRQILHMIKYRYVPF SFGKQVFHC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |