Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0531200_circ_g.1 |
ID in PlantcircBase | osa_circ_014898 |
Alias | Os02circ14311 |
Organism | Oryza sativa |
Position | chr2: 19550621-19552296 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os02g0531200 |
Parent gene annotation |
Bile acid:sodium symporter family protein. (Os02t0531200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf and panicle |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0531200-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.11929909 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19550651-19550623(+) |
Potential amino acid sequence |
MDPTLGCLAHKYSLSKYSTFGIFLISGLTLRTKELGAALEAWPAGLFGLASILLFTPFLAQFIM QIKFFPHEFITGLAMFCCMPTTLSSGVTLTQLVGGNTALALAMTAISNLLGIMIVPLSLAKYIG VGAGVSLPTEKLFKSLVTTLLIPIILGKL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |