Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0625500_circ_g.7 |
| ID in PlantcircBase | osa_circ_015576 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 24942703-24943254 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0625500 |
| Parent gene annotation |
Similar to Adenosine kinase-like protein (Fragment). (Os02t06255 00-01);Similar to Adenosine kinase-like protein (Fragment). (Os0 2t0625500-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0625500_circ_g.6 Os02g0625500_circ_g.8 Os02g0625500_circ_g.9 Os02g0625500_circ_g.10 Os02g0625500_circ_g.11 Os02g0625500_circ_g.12 Os02g0625500_circ_g.13 Os02g0625500_circ_g.14 Os02g0625500_circ_g.15 Os02g0625500_circ_g.16 Os02g0625500_circ_g.17 Os02g0625500_circ_g.18 Os02g0625500_circ_g.19 Os02g0625500_circ_g.20 |
| Support reads | 94 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0625500-01:3 Os02t0625500-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211931748 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24943176-24942757(+) 24943040-24943181(-) 24942711-24943080(-) 24943080-24943080(-) |
| Potential amino acid sequence |
MLSNKLNRIWGDRKEKASNVDVFCFLHSHPRTLAKILASVSLPKM*(+) MPRRRFFRLWTTSSVTKQKQESLLKSVDGSGESKIHLHCWLFPYGLPRFYSACC*(-) MGVEKAKYIYIAGFFLTVSPDSIQLVAEHAAANNKVFLMNLSAPFICEFFRDAQEKVLPFVDYI FGNETEARIFAKVRGWEWRKQNTSTLLAFSLRSPQILFSLLLSMLPLTTRCS*(-) MNLSAPFICEFFRDAQEKVLPFVDYIFGNETEARIFAKVRGWEWRKQNTSTLLAFSLRSPQILF SLLLSMLPLTTRCS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |