Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | scaffold78.372_circ_g.1 |
| ID in PlantcircBase | ecr_circ_000751 |
| Alias | NA |
| Organism | Echinochloa crus-galli |
| Position | chrscaffold78: 4533276-4533435 JBrowse» |
| Reference genome | Echinochloa crus-galli v2 |
| Type | e-circRNA |
| Identification method | circseq-cup |
| Parent gene | scaffold78.372 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | No-Yes |
| Splicing signals | CT-GC |
| Number of exons covered | scaffold78.372:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4533362-4533415(-) |
| Potential amino acid sequence |
MLRPAYAVEYDYLPAYQCSRSLMTKKFEGLFHWAS* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | NA |