Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0694300_circ_g.3 |
ID in PlantcircBase | osa_circ_003455 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 28685070-28685368 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0694300 |
Parent gene annotation |
Similar to T17H3.9. (Os01t0694300-01) |
Parent gene strand | - |
Alternative splicing | Os01g0694300_circ_igg.1 Os01g0694300_circ_igg.2 Os01g0694300_circ_igg.3 Os01g0694300_circ_igg.4 Os01g0694300_circ_ig.1 Os01g0694300_circ_ig.2 Os01g0694300_circ_ig.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0694300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.268886957 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28685324-28685125(+) 28685361-28685334(-) |
Potential amino acid sequence |
MPILRTQPTALAFSISGQDAVHVPLINKGTKRSS*(+) MPKLWVGFLKLAYQTQPRSFDVILQLPPPQLEIALNKYPNLRTPLCSFVNQRNMHSILPRYGKC QSCGLGS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |