Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0565600_circ_g.2 |
| ID in PlantcircBase | osa_circ_008046 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 22390387-22391552 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0565600 |
| Parent gene annotation |
E3 ligases of H2Bub1, Transcriptional regulation of anther devel opment (Os10t0565600-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0565600-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002961* osi_circ_008720 |
| PMCS | 0.312820176 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22390405-22390392(+) 22390484-22391543(-) |
| Potential amino acid sequence |
MAELEESRRKLAVLQLQTGGGSLMNTSAPNGVNGSVSTDKSSDKGMGWRDLKDAVEEAKTLAAN RLFELHETQEDNLILSKQLEDIQDQLKDENYIVTSKPYTILSDQLHHLNAEIERYRGLVEVLQN EKDQLMQKEEEMLAKAESVDAVQQSITTYKAKIEDLEHEIQKLMAEKNDLEIKAEEALQDSGKK DFKDEIHVMAASLSKEMELLDNQMNRSKDAASEALALREEADYLRTLLAKKVS*(+) MCSSVSLHPFATGEQPTFDGFPQALPCFPLAHLLS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |