Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0565600_circ_g.2 |
ID in PlantcircBase | osa_circ_008046 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 22390387-22391552 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0565600 |
Parent gene annotation |
E3 ligases of H2Bub1, Transcriptional regulation of anther devel opment (Os10t0565600-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0565600-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002961* osi_circ_008720 |
PMCS | 0.312820176 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22390405-22390392(+) 22390484-22391543(-) |
Potential amino acid sequence |
MAELEESRRKLAVLQLQTGGGSLMNTSAPNGVNGSVSTDKSSDKGMGWRDLKDAVEEAKTLAAN RLFELHETQEDNLILSKQLEDIQDQLKDENYIVTSKPYTILSDQLHHLNAEIERYRGLVEVLQN EKDQLMQKEEEMLAKAESVDAVQQSITTYKAKIEDLEHEIQKLMAEKNDLEIKAEEALQDSGKK DFKDEIHVMAASLSKEMELLDNQMNRSKDAASEALALREEADYLRTLLAKKVS*(+) MCSSVSLHPFATGEQPTFDGFPQALPCFPLAHLLS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |